2024-03-09_00000226_1_11 Domain 5 Parse 1 Confidence: 0.01
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 601198 | Error | Structure prediction | cameo | 2024-03-09_00000226_1_11 | 1937 | 11 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 595904 | 5 | 1 | 0.01 | comparative modeling | 1850-1931 | 82 | 12 Mar 2024 |
>595904
GSGGAAAAAAAGAAAASSGQGNGNGAAAAAADSERRSSVLSVPSGPRHTPSMDSLNDDPSRQVMGKAEQKLISEEDLNSAVD
>6hnsA_201 weight: 1.0000 score: 22.11 eval: 280 prob: 20.8 identity: 0.1098 startpos: 408
---------------------------MGYRNKCYRSLMTGTLATPHHTPWLDALDDSLEAYL-------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington