Yme1p2 Domain 1 Parse 1 Confidence: 0.27
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
648789 | Active | Structure prediction | mariellaqc | Yme1p2 | 176 | 14 Dec 2024 | 5 Feb 2025 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
642303 | 1 | 1 | 0.27 | comparative modeling | 1-88 | 88 | 14 Dec 2024 |
>642303
MNVSKILVSPTVTTNVLRIFAPRLPQIGASLLVQKKWALRSKKFYRFYSEKNSGEMPPKKEADSSGKASNKSTISSIDNSQPPPPSNT
>4cekA_101 weight: 1.0000 score: 24.4 eval: 0.023 prob: n/a identity: 0.0568 startpos: 178
-----------FSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMM---------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington