T1011 Domain 1 Parse 1 Confidence: 0.51
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 451 | Complete | Structure prediction | casp | T1011 | 534 | 6 Jul 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 647 | 1 | 1 | 0.51 | comparative modeling | 1-47 | 47 | 6 Jul 2018 |
>647
DYKDDDDGAPKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLT
>5yixB_302 weight: 1.0000 score: 8.36 eval: n/a prob: n/a identity: 0.1489 startpos: 5
TVLTLGAHMCKWPIGDPSSEGFTFCGRRSSEGPYCVEHARVAYQ---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington