Eurytoxin_Micruroides_euryxanthus Domain 1 Parse 1 Confidence: 0.70
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 694277 | Expired | Structure prediction | mizenamo_stewart | Eurytoxin_Micruroides_eur... | 64 | 18 Nov 2025 | 3 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 685216 | 1 | 1 | 0.70 | comparative modeling | 1-64 | 64 | 19 Nov 2025 |
>685216
MICHYNFQQSSEPPTTKTCPDGQCYKKNWSDHRGSKTERSGCGCPNVKPGIRINCCTDKCNAKL
>7rd1A_w040 weight: 1.0000 score: 0.45304 eval: n/a prob: n/a identity: 0.0625 startpos: 15
KPSSQ--WEQDTMEHTF-GVENITG--LQIALKKMKPCGGQAYLPPGSYSAANLKTKVYSGA--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington