T1019s1 Domain 1 Parse 1 Confidence: 0.97
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 481 | Complete | Structure prediction | casp | T1019s1 | 58 | 12 Jul 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 686 | 1 | 1 | 0.97 | comparative modeling | 1-58 | 58 | 12 Jul 2018 |
>686
GSYPCPCCGNKTIDEPGCYEICPICGWEDDPVQSADPDFSGGANSPSLNEAKRAFNEQ
>5k2mF_302 weight: 1.0000 score: 8.71 eval: n/a prob: n/a identity: 0.1724 startpos: 1
-MVECPVCGSEivELHQ-IVECPVCGAELEVVSLEPLTLEELPEVEEDWGE-------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington