S32L_CM2 Domain 1 Parse 1 Confidence: 0.45
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 700975 | Complete | Structure prediction | haramos | S32L_CM2 | 62 | 5 Feb 2026 | 23 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 691316 | 1 | 1 | 0.45 | comparative modeling | 1-62 | 62 | 6 Feb 2026 |
>691316
MPRRQWRWTRMTLTRAHYKIDGQLCLHWRPNLENLRGNLQIWWQLKNWLQNQLIQQGLSLMI
>3ffdP_202 weight: 1.0000 score: 16.23 eval: 210 prob: 27.7 identity: 0.0161 startpos: 1
-------------------------------------SI-QDLRRRFFLHHLIAEI------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington