2021-05-01_00000159_1_11 Domain 3 Parse 1 Confidence: 0.31
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
73478 | Complete | Structure prediction | cameo | 2021-05-01_00000159_1_11 | 1380 | 1 May 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
71537 | 3 | 1 | 0.31 | comparative modeling | 1306-1380 | 75 | 2 May 2021 |
>71537
PEAPRDGQAYVRKDGEWVLLSTFLGRSLEVLFQGPGHHHHHHHHSAWSHPQFEKGGGSGGGGSGGSAWSHPQFEK
>7lvwB_201 weight: 0.9976 score: 73.98 eval: 1.4e-06 prob: 98.29 identity: 0.4133 startpos: 457
PEAPRDGQAYVRKDGEWVLLSTFLG-SLEVLF-------------------------------------------
>7lvwF_204 weight: 0.0024 score: 105.48 eval: 5.1e-16 prob: 98.89 identity: 0.4267 startpos: 460
PEAPRDGQAYVRKDGEWVLLSTFLG-SLEVLFQ------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington