T1020 Domain 3 Parse 1 Confidence: 0.22
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 516 | Complete | Structure prediction | casp | T1020 | 577 | 19 Jul 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 745 | 3 | 1 | 0.22 | comparative modeling | 514-577 | 64 | 20 Jul 2018 |
>745
FPNDLAIAITKDRQNGGARPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKTNSADKEEEEKTD
>5nywH_103 weight: 1.0000 score: 18.92 eval: 0.035 prob: n/a identity: 0.0312 startpos: 42
--RTLVVQSAGN---------------LATTQSIVSLLQRR-----------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington