2021-06-05_00000109_1_19 Domain 4 Parse 1 Confidence: 0.25
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
79727 | Complete | Structure prediction | RoseTTAFold | 2021-06-05_00000109_1_19 | 1319 | 5 Jun 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
77762 | 4 | 1 | 0.25 | comparative modeling | 616-742 | 127 | 6 Jun 2021 |
>77762
YMLKQLEEASRSFAHLLRPGSLQSAQQQTSFLKEYIQTQNELVKRSPELGLLPHALPQVVQSSVRVLTLVQSPSAVAPHVPATNIDINSNLTADEPIWNKIEEMLVITAANNKPFVFKPSRYLYTKQ
>2gw6A_303 weight: 1.0000 score: 5.23 eval: n/a prob: n/a identity: 0.0315 startpos: 1
-SEDAWMGTHPKYLEMMELDIGD-----ATQVYVAFLVYLDLMESKS---WHEVNCVGLPELQLICLVGTEIEGEGL----QTVVPTPITASLSHNRIREILKASRKLQ-GDPDLPMSFTLAIVESD
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington