2021-07-17_00000178_2_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 96494 | Complete | Structure prediction | cameo | 2021-07-17_00000178_2_11 | 1206 | 17 Jul 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 91532 | 1 | 1 | 0.00 | comparative modeling | 1-96 | 96 | 18 Jul 2021 |
>91532
MDSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSAVDLEVLFQGPGMISAPDVVAFTKEEEYEEEPYNEPALPEEYSVPLFPFASQGANPWSKLSGA
>4cyuA_101 weight: 1.0000 score: 14.47 eval: 0.022 prob: n/a identity: 0.0625 startpos: 91
----------------------------------LDVDILLYGEEMIDLPKLSVP-----------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington