2021-08-21_00000149_1_19 Domain 1 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 114278 | Complete | Structure prediction | RoseTTAFold | 2021-08-21_00000149_1_19 | 1496 | 21 Aug 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 110941 | 1 | 1 | 0.07 | comparative modeling | 1-111 | 111 | 22 Aug 2021 |
>110941
MSKEQLLIQRSSAAERCRRYRQKMSAEQRASDLERRRRLQQNVSEEQLLEKRRSEAEKQRRHRQKMSKDQRAFEVERRRWRRQNMSREQSSTSTTNTGRNCLLSKNGVHED
>6z0cA_101 weight: 1.0000 score: 43.35 eval: 0.018 prob: n/a identity: 0.1171 startpos: 25
QLIRELLKIKLQIIKQLREASEKARNPEKKSVLQKQLELEEKQIelETLQQTAQEAQQL---------LQELQQTGQELWQL-----------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington