2021-08-21_00000149_1_11 Domain 6 Parse 1 Confidence: 0.04
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
114277 | Complete | Structure prediction | cameo | 2021-08-21_00000149_1_11 | 1496 | 21 Aug 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
110968 | 6 | 1 | 0.04 | comparative modeling | 637-701 | 65 | 22 Aug 2021 |
>110968
MVHGPCGIQNPNSPCMENGKCSKGYPKEFQNATIGNIDGYPKYKRRSGSTMSIGNKVVDNTWIVP
>4mw3A_w000 weight: 1.0000 score: 0.00471 eval: n/a prob: n/a identity: 0.0308 startpos: 143
IFAIMATGERFPEWFGTLGESFYTLFQVM--TLDDWSMGIVRPLMEVYPYAWVFFIPFIFVVTFV
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington