2022-01-29_00000279_1_11 Domain 6 Parse 1 Confidence: 0.10
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
200291 | Complete | Structure prediction | cameo | 2022-01-29_00000279_1_11 | 1239 | 29 Jan 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
197286 | 6 | 1 | 0.10 | comparative modeling | 1162-1239 | 78 | 30 Jan 2022 |
>197286
GFSPSNKWDVSTAARMQQRRVISLMDDLMSESETFARSAHSNHSLLQQIRRSYVKARKRGDLHTVKALQLRLKGFFQI
>4uosA_107 weight: 0.5475 score: 45.91 eval: 0.031 prob: n/a identity: 0.0769 startpos: 18
----------KKMLEKAIKKVKEMLEKMIKEIKKMLENGEDSEKILKKAKEMAEKILKM-VIELAEKILKKAKEMAEK
>6csvA_310 weight: 0.4525 score: 5.4 eval: n/a prob: n/a identity: 0.1667 startpos: 1
AHMTRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTAleGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEM
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington