T1033 Domain 1 Parse 1 Confidence: 0.08
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
27277 | Complete | Structure prediction | casp | T1033 | 100 | 26 May 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
26405 | 1 | 1 | 0.08 | comparative modeling | 1-100 | 100 | 26 May 2020 |
>26405
EFDSFTSPDLTNEIKEITDQLSYYIYNKHFSSDFEQVEGAKLNIQNEISQFVKEGKAPVQAAYNKLQDPDIKDLLDYYDNIEKHSDEFESEIVKFFSEKK
>4uosA_104 weight: 1.0000 score: 63.19 eval: 0.015 prob: n/a identity: 0.1100 startpos: 4
-------EEVKKMLEKMIEEIKKMLEKA-----IKKVKEMLEKMIKEIKKMLENGEdkILKKAKEMAEKILKMVIELAEKILKKAKEMAEKILKKVKELG
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington