T1046s1 Domain 1 Parse 1 Confidence: 0.23
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 28402 | Complete | Structure prediction | casp | T1046s1 | 74 | 5 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 27824 | 1 | 1 | 0.23 | comparative modeling | 1-74 | 74 | 5 Jun 2020 |
>27824
MNVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE
>5fdnB_101 weight: 1.0000 score: 39.27 eval: 0.021 prob: n/a identity: 0.0676 startpos: 36
-LHGEDLRETVQELYELSAEYEGKREPSKLEELGSVLTSL--------DPGDSIVISKAFSHMLNLANLAEE--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington