T1059 Domain 1 Parse 1 Confidence: 0.50
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 29633 | Complete | Structure prediction | casp | T1059 | 32 | 17 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 28994 | 1 | 1 | 0.50 | comparative modeling | 1-32 | 32 | 17 Jun 2020 |
>28994
TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR
>6mztA_304 weight: 1.0000 score: 13.25 eval: n/a prob: n/a identity: 0.3125 startpos: 2
DIKCSGTRQCWGPccTNS---KCMNGKCKCYG
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington