T1087 Domain 1 Parse 1 Confidence: 0.11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 32521 | Complete | Structure prediction | casp | T1087 | 93 | 16 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 31399 | 1 | 1 | 0.11 | comparative modeling | 1-93 | 93 | 16 Jul 2020 |
>31399
GAMEVVPAPEHPANISAPATSPTEHQEAAALHKKHAEHHKGMAVHHESVAAEYGKAGHPELKKHHEAMAKHHEALAKEHEKAAENHEKMAKPK
>5lb7B_307 weight: 1.0000 score: 6.38 eval: n/a prob: n/a identity: 0.0968 startpos: 1
-------------------MSLQMIVENVKLAREYAlnYDSAMVYYQGVLDQMNKysVKD-THLRQKWQQVWQEINVEAKQVKDIMKTLESFK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington