2022-07-02_00000191_1_11 Domain 6 Parse 1 Confidence: 0.09
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 355920 | Complete | Structure prediction | cameo | 2022-07-02_00000191_1_11 | 1187 | 2 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 362189 | 6 | 1 | 0.09 | comparative modeling | 882-943 | 62 | 12 Jul 2022 |
>362189
QTREMTFLAHGINHIAYDPRSWMKTLTAVRGRAPTSFLLWVVLIESSIVLALSKFFGESFDL
>6e4jA_302 weight: 1.0000 score: 5.76 eval: n/a prob: n/a identity: 0.1290 startpos: 21
YYNELKALVSKISSSVNDLEEAIVVLREEEKKASEP-------FKTDIRILLDFLESKP---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington