T0972 Domain 1 Parse 1 Confidence: 0.01
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
245 | Complete | Structure prediction | casp | T0972 | 106 | 24 May 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
378 | 1 | 1 | 0.01 | comparative modeling | 1-106 | 106 | 24 May 2018 |
>378
MVVDNTQKTSNAIFSTTTKVKEKNTSADEFQATLNEVKNKEEKEDKKTNSSKFTNEDIDLGAVREDFRSYAWQKMREDQYKKNEETLLNKLFTTIDAGNATNNTKA
>3hgfA_302 weight: 1.0000 score: 5.54 eval: n/a prob: n/a identity: 0.1321 startpos: 1
---PMVKEIEKKIENIVTKIDKKKYIYDNMKKLLNEIAEIEKDKTSLEEV-----KNINMSYGKSLNKLFLEkkKKSENMIKSMEKYIKDLDEIKEQSPKAEMNT-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington