2022-09-10_00000002_2_11 Domain 9 Parse 1 Confidence: 0.93
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 409036 | Complete | Structure prediction | cameo | 2022-09-10_00000002_2_11 | 1817 | 10 Sep 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 404359 | 9 | 1 | 0.93 | comparative modeling | 1769-1817 | 49 | 11 Sep 2022 |
>404359
SDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
>3a02A_303 weight: 0.9373 score: 6.04 eval: n/a prob: n/a identity: 0.1429 startpos: 1
-----TFTSFQLEELEKAFSRTHYPDVFTREELAMKiqVWFQNRRAKWR
>1p7jA_304 weight: 0.0351 score: 6.04 eval: n/a prob: n/a identity: 0.0816 startpos: 1
-RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSElkIWFQNERAK--
>2l7mP_308 weight: 0.0153 score: 5.99 eval: n/a prob: n/a identity: 0.1020 startpos: 1
GSQRRQRTHFtlQELEATFQRNHYPDMSTREEIaaRVRVWFKNRRAKWR
>5z2tC_310 weight: 0.0124 score: 5.94 eval: n/a prob: n/a identity: 0.1633 startpos: 1
---RTAVTGSQTALLLRAFEKDRFPGIAAREELAREtqIWFQNRRARHP
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington