2023-05-13_00000202_2_11 Domain 1 Parse 1 Confidence: 0.74
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 517273 | Complete | Structure prediction | cameo | 2023-05-13_00000202_2_11 | 1905 | 13 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 512350 | 1 | 1 | 0.74 | comparative modeling | 21-72 | 52 | 14 May 2023 |
>512350
SSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCS
>1n7dA_206 weight: 1.0000 score: 110.71 eval: 8.5e-18 prob: 99.18 identity: 0.3846 startpos: 1
---SVTCKSGDFSCG-----GNRCIPQFWRCDGQVDC-NGSDEQGCPPKTCS
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington