2023-05-13_00000202_1_11 Domain 2 Parse 1 Confidence: 0.67
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 517264 | Complete | Structure prediction | cameo | 2023-05-13_00000202_1_11 | 2068 | 13 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 514304 | 2 | 1 | 0.67 | comparative modeling | 164-244 | 81 | 19 May 2023 |
>514304
VPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGS
>7rd1J_w007 weight: 1.0000 score: 0.11504 eval: n/a prob: n/a identity: 0.0247 startpos: 4
-------AF----S-----LGNLNATRYFGVKVKNGNES------EWEGRVVPGNDLT-VDGKDY-----Q-AQGQP-YP-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington