2023-10-07_00000186_1_11 Domain 1 Parse 1 Confidence: 0.32
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
555633 | Complete | Structure prediction | cameo | 2023-10-07_00000186_1_11 | 1337 | 7 Oct 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
550453 | 1 | 1 | 0.32 | comparative modeling | 1-93 | 93 | 7 Oct 2023 |
>550453
MEHRYNVFNDTPRGNHWMGSSVSGSPRPSYSSRPNVNTTRRFQYSDDEPAEKIRPLRSRSFKSTESNISDEKSRISERDSKDRYINGDKKVDI
>6srsQ_303 weight: 0.9542 score: 7.14 eval: n/a prob: n/a identity: 0.1075 startpos: 1
--------SLLRQCPLLLPQNREGTAYEGFVSAQGRDFHIRILLPTDSQLKNARIECSWhkKILHGYQHILKQRLHSCPDLVSFVVELKTILE
>6sriQ_304 weight: 0.0458 score: 7.14 eval: n/a prob: n/a identity: 0.1075 startpos: 1
--------SLLRQCPLLLPQNREGTAYEGFVSAQGRDFHIRILLPTDSQLKNARIECSWhkKILHGYQHILKQRLHSCPDLVSFVVELKTILE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington