2023-10-21_00000099_1_11 Domain 8 Parse 1 Confidence: 0.96
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 557526 | Complete | Structure prediction | cameo | 2023-10-21_00000099_1_11 | 1993 | 21 Oct 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 552379 | 8 | 1 | 0.96 | comparative modeling | 1246-1305 | 60 | 22 Oct 2023 |
>552379
LNAKGNQILPALTPGSEFQVVKITNMTTIEREYAALESLQYYDLMDEILKAQPSPMLTFG
>1nraA_w000 weight: 1.0000 score: 0.00255 eval: n/a prob: n/a identity: 0.0333 startpos: 1
-------KKDGYPVDSGNCKYECLKDDYCNDLCLERKADKGYCYWGKVSCYCYGLPDNS-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington