2023-10-21_00000099_1_19 Domain 3 Parse 1 Confidence: 0.23
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
557527 | Complete | Structure prediction | RoseTTAFold | 2023-10-21_00000099_1_19 | 1993 | 21 Oct 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
552391 | 3 | 1 | 0.23 | comparative modeling | 378-459 | 82 | 22 Oct 2023 |
>552391
LVTEGDSQVPALAAWMRALVRSLPSTSWSDLCETSLRHLFETFRSDQAVDQSGRATCTLAGLVTLQQCLDGFLQQDSIDTGT
>1xl3C_310 weight: 1.0000 score: 5.34 eval: n/a prob: n/a identity: 0.1098 startpos: 1
--AYDLSEfgDIVALVddIEHLANAFSlpEIKVRFYQDLKRMFRLFpvFSDE---EQRQNLLQMCQNAIDMAIESEEEELSE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington