2024-03-09_00000226_1_19 Domain 5 Parse 1 Confidence: 0.01
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
601020 | Complete | Structure prediction | RoseTTAFold | 2024-03-09_00000226_1_19 | 1937 | 9 Mar 2024 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
595341 | 5 | 1 | 0.01 | comparative modeling | 1850-1931 | 82 | 10 Mar 2024 |
>595341
GSGGAAAAAAAGAAAASSGQGNGNGAAAAAADSERRSSVLSVPSGPRHTPSMDSLNDDPSRQVMGKAEQKLISEEDLNSAVD
>2v6l0_302 weight: 1.0000 score: 9.26 eval: n/a prob: n/a identity: 0.0610 startpos: 1
SVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKN---PSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQ
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington