2024-03-09_00000226_1_11 Domain 4 Parse 1 Confidence: 0.50
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 601198 | Error | Structure prediction | cameo | 2024-03-09_00000226_1_11 | 1937 | 11 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 595903 | 4 | 1 | 0.50 | comparative modeling | 1799-1853 | 55 | 12 Mar 2024 |
>595903
AFPRDAFAAHIRSFYPLVVELLGKDLGQDLRAALLLVLRRVGEVGLGIEGMGSGG
>3ajfA_303 weight: 1.0000 score: 6.12 eval: n/a prob: n/a identity: 0.2000 startpos: 32
SFDEHMFLQMIrvFLKSAIWMLShdLPGHYRLPLTCLVSTYSEYFVELKP-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington