2024-05-11_00000235_1_11 Domain 2 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 616936 | Complete | Structure prediction | cameo | 2024-05-11_00000235_1_11 | 1007 | 11 May 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 611146 | 2 | 1 | 0.07 | comparative modeling | 914-1007 | 94 | 12 May 2024 |
>611146
DPKAHPFWEHNAAEWFSLHRHLVVDFPKVECWENVTKAFLTNDTTVLSAYPPNMGNDVFVMPIEEFLRDYNSTICVPFSSGFFGQDPQNSDIQH
>6dm4A_302 weight: 1.0000 score: 5.24 eval: n/a prob: n/a identity: 0.0851 startpos: 1
--------SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKafILRWSSAntENKYVFIAASFQASdhSIRYGINKNGELFSINTASNKVTP
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington