2024-12-14_00000209_1_19 Domain 3 Parse 1 Confidence: 0.36
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 648818 | Complete | Structure prediction | RoseTTAFold | 2024-12-14_00000209_1_19 | 1255 | 14 Dec 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 642334 | 3 | 1 | 0.36 | comparative modeling | 1196-1255 | 60 | 15 Dec 2024 |
>642334
WYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
>1qcrI_302 weight: 1.0000 score: 8.32 eval: n/a prob: n/a identity: 0.0000 startpos: 1
----------------------GVAGAL---RPLVQAAVPATSESPVLDL----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington