E1B1 94T TO L Domain 1 Parse 1 Confidence: 0.26
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 702271 | Complete | Structure prediction | Sherry717CQMU | E1B1 94T TO L | 95 | 12 Mar 2026 | 28 Apr 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 692515 | 1 | 1 | 0.26 | comparative modeling | 1-95 | 95 | 14 Mar 2026 |
>692515
MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNVVQVAELYPELRRILTILE
>1jfwA_304 weight: 0.5350 score: 1.7 eval: n/a prob: n/a identity: 0.1474 startpos: 1
MEPVDPrePWKHPGSQPKTACTTccFHCQVCFtaLGISYGRKKRRQRRRPPQGSQTHQVSLSKqtSQPRGDPTGPKE------------------
>1jfwA_104 weight: 0.4650 score: 1.7 eval: n/a prob: n/a identity: 0.1474 startpos: 1
MEPVDPrePWKHPGSQPKTACTTccFHCQVCFtaLGISYGRKKRRQRRRPPQGSQTHQVSLSKqtSQPRGDPTGPKE------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington