2021-07-03_00000164_1_11 Domain 2 Parse 1 Confidence: 0.45
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 88859 | Complete | Structure prediction | cameo | 2021-07-03_00000164_1_11 | 2210 | 3 Jul 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 86624 | 2 | 1 | 0.45 | comparative modeling | 2158-2210 | 53 | 4 Jul 2021 |
>86624
LDKFGDWLEFSNFKVAFSRSLNDLLISDPQGQFRLKGVTCRPLKHKVEIKDID
>6dknA_102 weight: 1.0000 score: 23.18 eval: 0.0074 prob: n/a identity: 0.0943 startpos: 186
------RTKLGAHRVMMGAEMDCCDVSdkRFYVELKTTRE-------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington