2021-10-23_00000164_1_11 Domain 2 Parse 1 Confidence: 0.34
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 142572 | Complete | Structure prediction | cameo | 2021-10-23_00000164_1_11 | 1352 | 23 Oct 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 138898 | 2 | 1 | 0.34 | comparative modeling | 1004-1044 | 41 | 23 Oct 2021 |
>138898
AYSVDARGQKSQLEHEFYELQPLASHSCTSSEKTTYEEPHT
>2mi5A_303 weight: 1.0000 score: 8.58 eval: n/a prob: n/a identity: 0.2195 startpos: 15
KYDVECDSGEcqKQYLWYKWRPLDCRCLKssSKCVCRDV--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington