2021-11-13_00000175_1_19 Domain 19 Parse 1 Confidence: 0.25
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 150144 | Error | Structure prediction | RoseTTAFold | 2021-11-13_00000175_1_19 | 2839 | 13 Nov 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 147770 | 19 | 1 | 0.25 | comparative modeling | 2798-2839 | 42 | 17 Nov 2021 |
>147770
NVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
>5zluz_304 weight: 1.0000 score: 8.76 eval: n/a prob: n/a identity: 0.1667 startpos: 9
RRKRAKTHGFRARMRTPGGR-KVLKRRRQKGRWRLTPAVRKR
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington