T0953s2 Domain 1 Parse 1 Confidence: 0.34
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 141 | Complete | Structure prediction | casp | T0953s2 | 249 | 4 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 211 | 1 | 1 | 0.34 | comparative modeling | 1-50 | 50 | 5 May 2018 |
>211
MAVQGPWVGSSYVAETGQNWASLAANELRVTERPFWISSFIGRSKEEIWE
>4lb5A_303 weight: 1.0000 score: 6.16 eval: n/a prob: n/a identity: 0.1000 startpos: 1
---EIEMRICDYLRRHGRSTVQDIFKELKLEKSTvhLYSLQASKQVFKTV
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington