T0960 Domain 4 Parse 1 Confidence: 0.02
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
171 | Complete | Structure prediction | casp | T0960 | 384 | 11 May 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
254 | 4 | 1 | 0.02 | comparative modeling | 227-284 | 58 | 11 May 2018 |
>254
FTWAALPGKPATFPPSGHNHDTSQITSGILPLARGGLGANTAAGARNNIGAGVPATAS
>3bogA_302 weight: 1.0000 score: 9.49 eval: n/a prob: n/a identity: 0.1379 startpos: 18
AAGSVGggCDGGHGGNGGNGncAGGVGGAgaSGGTGVGGRGGKGGSGTPKGADGAPGA
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington