T1030 Domain 2 Parse 1 Confidence: 0.45
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 26616 | Complete | Structure prediction | casp | T1030 | 273 | 22 May 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 25975 | 2 | 1 | 0.45 | comparative modeling | 74-133 | 60 | 22 May 2020 |
>25975
ISPEVLEEYKEKIQRASTKSQVDEFVAEAKKVVNSNKETLVNQANGKKQEIAKLENLSND
>5oqmj_302 weight: 1.0000 score: 6.78 eval: n/a prob: n/a identity: 0.0833 startpos: 5
FIPHIFYSLHQIRKDETLTGSIRHRLKLCKSLISEnqDIIHQREQELQIKRDVLDDLYR-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington