T1035 Domain 1 Parse 1 Confidence: 0.05
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 27376 | Complete | Structure prediction | casp | T1035 | 102 | 27 May 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 26609 | 1 | 1 | 0.05 | comparative modeling | 1-102 | 102 | 27 May 2020 |
>26609
ANVKLMLSFLPKIDNLTGEPALGDYLNKPVFRSFDSIHSELLEVLSDITTLHVQGEVLDVFSSMYNKIKELADFKKSFKPLLEILDTIDEQKKTEFVQAFYL
>1yozB_302 weight: 1.0000 score: 5.3 eval: n/a prob: n/a identity: 0.1373 startpos: 4
LYINSFLDRMGEIIRGEKSVEEADKLLDQ-----KNIFEMFRSDCEEILNLYKSGKakEEVQRNFYLLKTYVVssIHFERLKEFAEslDPEVINEIALYIDR
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington