T1067 Domain 1 Parse 1 Confidence: 0.02
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 30616 | Complete | Structure prediction | casp | T1067 | 264 | 25 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 30000 | 1 | 1 | 0.02 | comparative modeling | 1-81 | 81 | 25 Jun 2020 |
>30000
MKRRILSVGRNYFLRGVIMNRLLTVFGVLLVATLASFNVFAQSRSELERRMMVEDSYEAPRGRLFNEQAYLRGETYLNQYT
>1qcrI_304 weight: 1.0000 score: 6.96 eval: n/a prob: n/a identity: 0.0123 startpos: 1
----------------------------GValVQaaTSESPVLD-------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington