T1094 Domain 1 Parse 1 Confidence: 0.01
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
33153 | Complete | Structure prediction | casp | T1094 | 496 | 23 Jul 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
32173 | 1 | 1 | 0.01 | comparative modeling | 1-108 | 108 | 23 Jul 2020 |
>32173
MISNFRKFHGNKNQEKFNENLILNKENESILNYLDPICKTLEIIPEITYLGSSVEPINKVYKFNKEEKTSDIERSELQLIKMSFLIEKDDKKEEINKFIYFPKLIDSQ
>m04tA_301 weight: 1.0000 score: 5.54 eval: n/a prob: n/a identity: 0.0926 startpos: 3
VERLGDDLVSeqEANKFYMERLAGRdaVTTRQTLRNIRDKVdlNSAFNPLVKLLDQTLR--GYEQHADGRNIVAPFFYQVVAAVLIMS--ERERIEEYANGSITV---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington