T0957s1_dom1 Domain 1 Parse 1 Confidence: 0.06
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 276 | Complete | Structure prediction | casp | T0957s1_dom1 | 75 | 30 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 416 | 1 | 1 | 0.06 | comparative modeling | 1-75 | 75 | 30 May 2018 |
>416
SNSFEVSSLPDANGKNHITAVKGDAKIPVDKIELYMRGKASGDLDSLQAEYNSLKDARISSQKEFAKDPNNAKRM
>3cecA_308 weight: 1.0000 score: 5.14 eval: n/a prob: n/a identity: 0.1067 startpos: 4
IHPGEVIADILDDLDINTANFAEILGVSNQTIQEVINGQRSITVDIAIRLGKAllNLQQKVDLWYALQSHKEEYE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington