T0980s2 Domain 1 Parse 1 Confidence: 0.25
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
282 | Complete | Structure prediction | casp | T0980s2 | 52 | 1 Jun 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
423 | 1 | 1 | 0.25 | comparative modeling | 1-52 | 52 | 1 Jun 2018 |
>423
VNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK
>1x9bA_308 weight: 1.0000 score: 6.19 eval: n/a prob: n/a identity: 0.1731 startpos: 8
KFESMINSPSKSVFVRNLNELEALAVRLGK------SYRIQLDQAKEKWKVK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington