2022-10-15_00000059_1_11 Domain 5 Parse 1 Confidence: 0.15
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 428110 | Complete | Structure prediction | cameo | 2022-10-15_00000059_1_11 | 1285 | 15 Oct 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 423681 | 5 | 1 | 0.15 | comparative modeling | 581-659 | 79 | 16 Oct 2022 |
>423681
GGPDFPRNQVYTKSTPLPRVRTKPPWVYTTTHPPLVQNRAMTTTMSKSAKKGNSKNLDDDILLSNETIQMSEAALRRNH
>6ql7M_103 weight: 1.0000 score: 12.85 eval: 0.052 prob: n/a identity: 0.0380 startpos: 63
--------------------------------------------------------------LYKDSVRENEIVLNNYN
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington