2022-12-17_00000196_1_19 Domain 2 Parse 1 Confidence: 0.27
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
465715 | Complete | Structure prediction | RoseTTAFold | 2022-12-17_00000196_1_19 | 2146 | 17 Dec 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
461057 | 2 | 1 | 0.27 | comparative modeling | 2104-2146 | 43 | 18 Dec 2022 |
>461057
QGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL
>1l5jA_102 weight: 1.0000 score: 12.6 eval: 0.024 prob: n/a identity: 0.1860 startpos: 5
--YRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington