2023-03-25_00000113_1_19 Domain 2 Parse 1 Confidence: 0.22
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
500206 | Error | Structure prediction | RoseTTAFold | 2023-03-25_00000113_1_19 | 1876 | 25 Mar 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
495199 | 2 | 1 | 0.22 | comparative modeling | 109-187 | 79 | 26 Mar 2023 |
>495199
GQYTASQMSYGEPNSSGTSTPIYGNYDPNAIAMALPNEPYPAWTADSQSPVSIEQIEDIFIDLTNRLGFQRDSMRNMFD
>2mg4A_303 weight: 0.9397 score: 7.12 eval: n/a prob: n/a identity: 0.1139 startpos: 1
--------MEKRPRT------EFSEEQKKALDLAFYFDRRLTPEWRRylGLNEEQIERWFRRKEQQ---IGWSHPQFEK
>5egoA_307 weight: 0.0315 score: 6.75 eval: n/a prob: n/a identity: 0.1392 startpos: 1
------------------AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLalTILQVNNWFINARRRIVQPM--------
>3zobA_308 weight: 0.0288 score: 6.5 eval: n/a prob: n/a identity: 0.0759 startpos: 1
----------GPMASDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQslGLNESQIKIWFQNKRAKIKKATQA------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington