ZX_S3C12 Mutant M14K Domain 1 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 52566 | Complete | Structure prediction | LJS5 | ZX_S3C12 Mutant M14K | 75 | 17 Jan 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 51315 | 1 | 1 | 0.33 | comparative modeling | 1-75 | 75 | 17 Jan 2021 |
>51315
PESALRRYVALRMKLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK
>6ds9A_303 weight: 1.0000 score: 5.95 eval: n/a prob: n/a identity: 0.1333 startpos: 3
WAEFKQRLAAIKTRLAAIKTRLqsEAELAAFEKEIAAFESEIAagNPEVEALRKEAAAIRDEAAAIRDELQAYRH
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington