2024-03-09_00000226_1_19 Domain 4 Parse 1 Confidence: 0.50
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 601020 | Complete | Structure prediction | RoseTTAFold | 2024-03-09_00000226_1_19 | 1937 | 9 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 595340 | 4 | 1 | 0.50 | comparative modeling | 1799-1853 | 55 | 10 Mar 2024 |
>595340
AFPRDAFAAHIRSFYPLVVELLGKDLGQDLRAALLLVLRRVGEVGLGIEGMGSGG
>6e4jA_309 weight: 1.0000 score: 5.76 eval: n/a prob: n/a identity: 0.0545 startpos: 19
VEYYNELKALVSKISSsaIVVLREEEKKafKTDIRILLDFLESKP----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington