Alireza Domain 1 Parse 1 Confidence: 0.29
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
642208 | Complete | Structure prediction | Alirezanmtp | Alireza | 30 | 13 Nov 2024 | 29 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
636086 | 1 | 1 | 0.29 | comparative modeling | 1-30 | 30 | 14 Nov 2024 |
>636086
GQTLVYWATKFHMRNLPEPDISACVAKLMN
>6z98A_102 weight: 1.0000 score: 14.63 eval: 0.053 prob: n/a identity: 0.1667 startpos: 112
--SIIKSTSHYHTkeIKEEHVKAGKEKASN
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington