W42E_CM2 Domain 1 Parse 1 Confidence: 0.31
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 700961 | Complete | Structure prediction | haramos | W42E_CM2 | 62 | 5 Feb 2026 | 22 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 691282 | 1 | 1 | 0.31 | comparative modeling | 1-62 | 62 | 5 Feb 2026 |
>691282
MPRRQWRWTRMTLTRAHYKIDGQLCLHWRPNSENLRGNLQIEWQLKNWLQNQLIQQGLSLMI
>5egoA_305 weight: 0.5119 score: 1.38 eval: n/a prob: n/a identity: 0.0645 startpos: 1
---AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM--
>5egoA_105 weight: 0.4567 score: 1.38 eval: n/a prob: n/a identity: 0.0645 startpos: 1
---AFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM--
>5eg0A_108 weight: 0.0161 score: 1.1 eval: n/a prob: n/a identity: 0.0645 startpos: 1
----APKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM--
>5eg0A_308 weight: 0.0152 score: 1.1 eval: n/a prob: n/a identity: 0.0645 startpos: 1
----APKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington