Peptide Folding Domain 1 Parse 1 Confidence: 0.22
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702133 | Complete | Structure prediction | Chaoyang | Peptide Folding | 39 | 9 Mar 2026 | 23 Apr 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692440 | 1 | 1 | 0.22 | comparative modeling | 1-39 | 39 | 9 Mar 2026 |
>692440
YGFRNVVHIAAAPSKPSFQEFVDWENVSPELNSTDQPFL
>7sauC_201 weight: 0.9859 score: 22.35 eval: 19 prob: 59.95 identity: 0.2821 startpos: 41
IgtEAVIFFFSAFEKP--APEYDWTLVYPEL--------
>7sauE_202 weight: 0.0141 score: 22.09 eval: 22 prob: 56.99 identity: 0.2821 startpos: 42
IgtEAVIFFFSAFEKP--APEYDWTLVYPEL--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington