7mada Domain 1 Parse 1 Confidence: 0.11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702482 | Complete | Structure prediction | PeterHanna | 7mada | 73 | 21 Mar 2026 | 6 May 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692653 | 1 | 1 | 0.11 | comparative modeling | 1-72 | 72 | 21 Mar 2026 |
>692653
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAIYTDDGETLMEEALRQQELEQRDTICYRN
>5evfA_305 weight: 0.5165 score: 5.78 eval: n/a prob: n/a identity: 0.0972 startpos: 5
ETKGVYLPKYSAELPPTDPSQVRVYNlgNIGQVRTSTHVSNekLCDKNLKEAIKLAAqcLYPEGQINeaFRD
>5evfA_109 weight: 0.4835 score: 5.78 eval: n/a prob: n/a identity: 0.0972 startpos: 5
ETKGVYLPKYSAELPPTDPSQVRVYNlgNIGQVRTSTHVSNekLCDKNLKEAIKLAAqcLYPEGQINeaFRD
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington